PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G163500.2
Common NamePHAVU_002G163500g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 81aa    MW: 9301.56 Da    PI: 9.8397
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G163500.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.1e-072261445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++++E++l+ +  k+ G + W++Ia +++ gR ++++  +w 
  Phvul.002G163500.2 22 MSEQEEDLIHRMYKLVGDK-WNLIAGRIP-GRKAEEIERFWI 61
                        589**************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00551866IPR001005SANT/Myb domain
CDDcd001671.33E-42260No hitNo description
Gene3DG3DSA:1.10.10.605.4E-102361IPR009057Homeodomain-like
PfamPF002491.6E-62361IPR001005SANT/Myb domain
SuperFamilySSF466896.24E-72361IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MSTTATSTTS EVSSKEWKVI HMSEQEEDLI HRMYKLVGDK WNLIAGRIPG RKAEEIERFW  60
IMRHTHAFSV TTNQSKAKHS *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP2381152e-75KP238115.1 Lablab purpureus caprice (cpc) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158569.12e-53hypothetical protein PHAVU_002G163500g
SwissprotQ8GV051e-28TRY_ARATH; Transcription factor TRY
TrEMBLV7CMH62e-53V7CMH6_PHAVU; Uncharacterized protein
STRINGGLYMA01G43435.11e-38(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.11e-26MYB_related family protein